Rabbit Anti-MDMX Antibody 352971 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-MDMX Antibody

Western blot analysis of MDMX expression in mouse testis extract (lane 1) and 22RV1 whole cell lysates (lane 2). MDMX at75KD was detected using rabbit MDMX at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Rabbit Anti-MDMX Antibody

MDMX was detected in paraffin-embedded sections of human lung cancer tissues using rabbit MDMX at 1ug/mL. The immunohistochemical section was developed using SABC method.

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-MDMX Antibody

The Rabbit Anti-MDMX Antibody from United States Biological is a Rabbit Polyclonal antibody to MDM4, and MDM4 regulator of p53. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Rabbit Anti-MDMX Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-MDMX Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number352971
Antibody TypePrimary
ReactivityHu, Mo
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to aa35-72 KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQ of human MDMX at N-terminal
TargetMDMX
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameMDM4 regulator of p53
NCBI Gene AliasesBMFS6, HDMX, MDMX, MRP1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!